PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00131557001
Common NameGSBRNA2T00131557001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 224aa    MW: 24638.1 Da    PI: 7.2637
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00131557001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof110.48.6e-352077461
               zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                          a+ cprC+s+ntkfCyynnys sqPry Ck+CrryWt+GG+lrnvP+Gg+ rk k++
  GSBRNA2T00131557001 20 PARVCPRCNSDNTKFCYYNNYSASQPRYKCKNCRRYWTHGGTLRNVPIGGTGRKIKRN 77
                         5789*************************************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-231676IPR003851Zinc finger, Dof-type
PfamPF027014.6E-312276IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.3262276IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102460IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010154Biological Processfruit development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000032Biological Processregulation of secondary shoot formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MDYSGLFVQD DNQVNEEKPP ARVCPRCNSD NTKFCYYNNY SASQPRYKCK NCRRYWTHGG  60
TLRNVPIGGT GRKIKRNRLD QPSFSQMISV ENQQVNHHQP FLNDQETNEF VGSSSSAAAV  120
VGGNHSGSLL EFHGDMVTNV PPFGSFPPMD ALHISDVSFQ QGYYDAGSSD LIGNPLVKQL  180
TGGSVVVSSN QEDPNMWNQS FNNTTNMNHN ASTSGGKGHI SKH*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00131557001
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1728783e-51AC172878.1 Brassica rapa subsp. oleifera cultivar Inbred line 'Chiifu' clone KBrH069E01, complete sequence.
GenBankAC2410203e-51AC241020.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB039B11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013669241.11e-166PREDICTED: dof zinc finger protein DOF4.4-like
RefseqXP_009134257.11e-166PREDICTED: dof zinc finger protein DOF4.4-like isoform X1
SwissprotQ9SUA92e-75DOF44_ARATH; Dof zinc finger protein DOF4.4
TrEMBLA0A078CPC41e-168A0A078CPC4_BRANA; BnaA01g10930D protein
STRINGBra013494.1-P1e-166(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16021789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21050.14e-69Dof-type zinc finger domain-containing protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]